Lineage for d3jy6c_ (3jy6 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143989Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2143990Protein automated matches [190646] (70 species)
    not a true protein
  7. 2144164Species Lactobacillus brevis [TaxId:387344] [225768] (1 PDB entry)
  8. 2144167Domain d3jy6c_: 3jy6 C: [212143]
    Other proteins in same PDB: d3jy6a2, d3jy6d2
    automated match to d2nzug_
    complexed with cl, edo

Details for d3jy6c_

PDB Entry: 3jy6 (more details), 1.97 Å

PDB Description: Crystal structure of LacI Transcriptional regulator from Lactobacillus brevis
PDB Compounds: (C:) Transcriptional regulator, LacI family

SCOPe Domain Sequences for d3jy6c_:

Sequence, based on SEQRES records: (download)

>d3jy6c_ c.93.1.0 (C:) automated matches {Lactobacillus brevis [TaxId: 387344]}
kliavivaniddyfstelfkgissilesrgyigvlfdanadierektllraigsrgfdgl
ilqsfsnpqtvqeilhqqmpvvsvdremdacpwpqvvtdnfeaakaattafrqqgyqhvv
vltselelsrtrqeryrgilaaaqdvdvlevsessynhsevhqrltqlitqndqktvafa
lkerwlleffpnliisglidnqtvtatgfadtdfirrmepkltlitqnpflmgassaeim
lrqlagekvapekmvipaklq

Sequence, based on observed residues (ATOM records): (download)

>d3jy6c_ c.93.1.0 (C:) automated matches {Lactobacillus brevis [TaxId: 387344]}
kliavivaniddyfstelfkgissilesrgyigvlfdanadierektllraigsrgfdgl
ilqsfsnpqtvqeilhqqmpvvsvdremdacpwpqvvtdnfeaakaattafqqgyqhvvv
ltselelsrtrqeryrgilaaaqdvdvlevsessynhsevhqrltqlitktvafalkerw
lleffpnliisglidnqtvtatgfadtdfirrmkltlitqnpflmgassaeimlrqlage
kvapekmvipaklq

SCOPe Domain Coordinates for d3jy6c_:

Click to download the PDB-style file with coordinates for d3jy6c_.
(The format of our PDB-style files is described here.)

Timeline for d3jy6c_: