Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
Protein automated matches [190646] (31 species) not a true protein |
Species Lactobacillus brevis [TaxId:387344] [225768] (1 PDB entry) |
Domain d3jy6a_: 3jy6 A: [212141] automated match to d2nzug_ complexed with cl, edo |
PDB Entry: 3jy6 (more details), 1.97 Å
SCOPe Domain Sequences for d3jy6a_:
Sequence, based on SEQRES records: (download)
>d3jy6a_ c.93.1.0 (A:) automated matches {Lactobacillus brevis [TaxId: 387344]} qsskliavivaniddyfstelfkgissilesrgyigvlfdanadierektllraigsrgf dglilqsfsnpqtvqeilhqqmpvvsvdremdacpwpqvvtdnfeaakaattafrqqgyq hvvvltselelsrtrqeryrgilaaaqdvdvlevsessynhsevhqrltqlitqndqktv afalkerwlleffpnliisglidnqtvtatgfadtdfirrmepkltlitqnpflmgassa eimlrqlagekvapekmvipaklqe
>d3jy6a_ c.93.1.0 (A:) automated matches {Lactobacillus brevis [TaxId: 387344]} qsskliavivaniddyfstelfkgissilesrgyigvlfdanadierektllraigsrgf dglilqsfsnpqtvqeilhqqmpvvsvdremdacpwpqvvtdnfeaakaattafrqqgyq hvvvltselelsrtrqeryrgilaaaqdvdvlevsessynhsevhqrltqlitqndqktv afalkerwlleffpnliisglidnqtvtatgfadtdfirrmkltlitqnpflmgassaei mlrqlagekvapekmvipaklqe
Timeline for d3jy6a_: