Lineage for d3jxua1 (3jxu A:4-188)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1372366Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1372729Protein automated matches [226905] (10 species)
    not a true protein
  7. 1372776Species Human (Homo sapiens) [TaxId:9606] [225574] (12 PDB entries)
  8. 1372797Domain d3jxua1: 3jxu A:4-188 [212139]
    Other proteins in same PDB: d3jxua2
    automated match to d2qw9a1
    complexed with adp, mg, po4

Details for d3jxua1

PDB Entry: 3jxu (more details), 2.14 Å

PDB Description: crystal structure of the human 70kda heat shock protein 1a (hsp70-1) atpase domain in complex with adp and inorganic phosphate
PDB Compounds: (A:) Heat shock 70 kDa protein 1

SCOPe Domain Sequences for d3jxua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jxua1 c.55.1.1 (A:4-188) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aaaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvalnp
qntvfdakrligrkfgdpvvqsdmkhwpfqvindgdkpkvqvsykgetkafypeeissmv
ltkmkeiaeaylgypvtnavitvpayfndsqrqatkdagviaglnvlriineptaaaiay
gldrt

SCOPe Domain Coordinates for d3jxua1:

Click to download the PDB-style file with coordinates for d3jxua1.
(The format of our PDB-style files is described here.)

Timeline for d3jxua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3jxua2