Lineage for d3jwni2 (3jwn I:122-205)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1304037Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1304224Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) (S)
  5. 1304225Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
  6. 1304243Protein FimC [49588] (1 species)
  7. 1304244Species Escherichia coli [TaxId:562] [49589] (8 PDB entries)
  8. 1304250Domain d3jwni2: 3jwn I:122-205 [212130]
    Other proteins in same PDB: d3jwnc1, d3jwnh1, d3jwnh2, d3jwni1, d3jwnn1, d3jwnn2
    automated match to d1bf8a2
    complexed with gol

Details for d3jwni2

PDB Entry: 3jwn (more details), 2.69 Å

PDB Description: Complex of FimC, FimF, FimG and FimH
PDB Compounds: (I:) chaperone protein fimc

SCOPe Domain Sequences for d3jwni2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jwni2 b.7.2.1 (I:122-205) FimC {Escherichia coli [TaxId: 562]}
lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsda
gsnityrtindygaltpkmtgvme

SCOPe Domain Coordinates for d3jwni2:

Click to download the PDB-style file with coordinates for d3jwni2.
(The format of our PDB-style files is described here.)

Timeline for d3jwni2: