SCOPe 2.04: Domain d3jwnc1: 3jwn C:1-121

Lineage for d3jwnc1 (3jwn C:1-121)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (3 families)
   contains PP switch between strands D and C'

5. Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
   automatically mapped to Pfam PF00345

6. Protein Periplasmic chaperone FimC [49358] (1 species)

7. Species Escherichia coli [TaxId:562] [49359] (8 PDB entries)

8. Domain d3jwnc1: 3jwn C:1-121 [212127]
   Other proteins in same PDB: d3jwnc2, d3jwnh1, d3jwnh2, d3jwni2, d3jwnn1, d3jwnn2
   automated match to d1bf8a1
   complexed with gol

Details for d3jwnc1

PDB Entry: 3jwn, 2.69 Å

PDB Description: Complex of FimC, FimF, FimG and FimH

PDB Compounds: (C:) chaperone protein fimc

SCOPe Domain Sequences for d3jwnc1:

Sequence, based on SEQRES records:

>d3jwnc1 b.1.11.1 (C:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a

Sequence, based on observed residues (ATOM records):

>d3jwnc1 b.1.11.1 (C:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmentlqlaiisriklyyrpakla

Timeline for d3jwnc1:

• d3jwnc1 first appeared in SCOPe 2.03
  
• d3jwnc1 appears in SCOPe 2.05
  
• d3jwnc1 appears in the current release, SCOPe 2.08