Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.11: PapD-like [49354] (3 families) contains PP switch between strands D and C' |
Family b.1.11.1: Pilus chaperone [49355] (6 proteins) automatically mapped to Pfam PF00345 |
Protein Periplasmic chaperone FimC [49358] (1 species) |
Species Escherichia coli [TaxId:562] [49359] (8 PDB entries) |
Domain d3jwnc1: 3jwn C:1-121 [212127] Other proteins in same PDB: d3jwnc2, d3jwnh1, d3jwnh2, d3jwni2, d3jwnn1, d3jwnn2 automated match to d1bf8a1 complexed with gol |
PDB Entry: 3jwn (more details), 2.69 Å
SCOPe Domain Sequences for d3jwnc1:
Sequence, based on SEQRES records: (download)
>d3jwnc1 b.1.11.1 (C:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]} gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl a
>d3jwnc1 b.1.11.1 (C:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]} gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk kentlrildatnnqlpqdreslfwmnvkaipsmentlqlaiisriklyyrpakla
Timeline for d3jwnc1: