SCOPe 2.03: Domain d3jwdo2: 3jwd O:108-213

Lineage for d3jwdo2 (3jwd O:108-213)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (12 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)
Domain d3jwdo2: 3jwd O:108-213 [212126]
Other proteins in same PDB: d3jwdc1, d3jwdc2, d3jwdd1, d3jwdd2, d3jwdl1, d3jwdo1
automated match to d1rhha2
complexed with gol, nag

Details for d3jwdo2

PDB Entry: 3jwd (more details), 2.61 Å

PDB Description: structure of hiv-1 gp120 with gp41-interactive region: layered architecture and basis of conformational mobility

PDB Compounds: (O:) Fab 48d light chain

SCOPe Domain Sequences for d3jwdo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jwdo2 b.1.1.2 (O:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhklyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d3jwdo2:

Click to download the PDB-style file with coordinates for d3jwdo2.
(The format of our PDB-style files is described here.)

Timeline for d3jwdo2: