SCOPe 2.08: Domain d3jvja1: 3jvj A:42-166

Lineage for d3jvja1 (3jvj A:42-166)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [196526] (5 PDB entries)

8. Domain d3jvja1: 3jvj A:42-166 [212121]
   Other proteins in same PDB: d3jvja2
   automated match to d2nxba_
   complexed with edo, gol

Details for d3jvja1

PDB Entry: 3jvj, 1.55 Å

PDB Description: Crystal structure of the bromodomain 1 in mouse Brd4

PDB Compounds: (A:) Bromodomain-containing protein 4

SCOPe Domain Sequences for d3jvja1:

Sequence; same for both SEQRES and ATOM records:

>d3jvja1 a.29.2.0 (A:42-166) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
stnppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdyykii
ktpmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqki
nelpt

Timeline for d3jvja1:

• d3jvja1 first appeared in SCOPe 2.03, called d3jvja_
  
• d3jvja1 appears in SCOPe 2.07