Lineage for d3jv5b_ (3jv5 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1771068Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1771069Protein automated matches [190226] (43 species)
    not a true protein
  7. 1771244Species Mouse (Mus musculus) [TaxId:10090] [226768] (5 PDB entries)
  8. 1771247Domain d3jv5b_: 3jv5 B: [212118]
    automated match to d1my5a_

Details for d3jv5b_

PDB Entry: 3jv5 (more details), 2.65 Å

PDB Description: Crystal structure of the dimerization domains p52 homodimer
PDB Compounds: (B:) Nuclear factor NF-kappa-B p100 subunit

SCOPe Domain Sequences for d3jv5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jv5b_ b.1.18.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
snlkisrmdktagsvrggdevyllcdkvqkddievrfyeddengwqafgdfsptdvhkqy
aivfrtppyhkmkierpvtvflqlkrkrggdvsdskqftyypl

SCOPe Domain Coordinates for d3jv5b_:

Click to download the PDB-style file with coordinates for d3jv5b_.
(The format of our PDB-style files is described here.)

Timeline for d3jv5b_: