![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [226768] (5 PDB entries) |
![]() | Domain d3jv5a_: 3jv5 A: [212117] automated match to d1my5a_ |
PDB Entry: 3jv5 (more details), 2.65 Å
SCOPe Domain Sequences for d3jv5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jv5a_ b.1.18.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} asnlkisrmdktagsvrggdevyllcdkvqkddievrfyeddengwqafgdfsptdvhkq yaivfrtppyhkmkierpvtvflqlkrkrggdvsdskqftyypl
Timeline for d3jv5a_: