SCOPe 2.06: Domain d3juza_: 3juz A:

Lineage for d3juza_ (3juz A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein automated matches [226855] (1 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224977] (9 PDB entries)

8. Domain d3juza_: 3juz A: [212115]
   automated match to d1my5a_
   mutant

Details for d3juza_

PDB Entry: 3juz, 2.51 Å

PDB Description: crystal structure of a mutant of relb dimerization domain(m5)

PDB Compounds: (A:) transcription factor relb

SCOPe Domain Sequences for d3juza_:

Sequence; same for both SEQRES and ATOM records:

>d3juza_ b.1.18.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tselricridkesgpctggeelyllcdkvqkedisvrfstaswegrgdfsqadvhrqiai
vfktppyedleisepvtvnvqlqrltdgecseplpftylpr

Timeline for d3juza_:

• d3juza_ first appeared in SCOPe 2.03
  
• d3juza_ appears in SCOPe 2.05
  
• d3juza_ appears in SCOPe 2.07
  
• d3juza_ appears in the current release, SCOPe 2.08