SCOPe 2.07: Domain d3juyb2: 3juy B:143-250

Lineage for d3juyb2 (3juy B:143-250)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d3juyb2: 3juy B:143-250 [212106]
   automated match to d1dzba2

Details for d3juyb2

PDB Entry: 3juy, 2.5 Å

PDB Description: crystal structure of a 3b3 variant, a broadly neutralizing hiv-1 scfv antibody

PDB Compounds: (B:) 3B3 single chain variant HIV-1 antibody

SCOPe Domain Sequences for d3juyb2:

Sequence; same for both SEQRES and ATOM records:

>d3juyb2 b.1.1.0 (B:143-250) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqapgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlvihgvsnrasgis
drfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtklerk

Timeline for d3juyb2:

• d3juyb2 first appeared in SCOPe 2.03
  
• d3juyb2 appears in SCOPe 2.06
  
• d3juyb2 appears in the current release, SCOPe 2.08