SCOPe 2.08: Domain d3juyb1: 3juy B:1-125

Lineage for d3juyb1 (3juy B:1-125)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3juyb1: 3juy B:1-125 [212105]
   automated match to d1dzba1

Details for d3juyb1

PDB Entry: 3juy, 2.5 Å

PDB Description: crystal structure of a 3b3 variant, a broadly neutralizing hiv-1 scfv antibody

PDB Compounds: (B:) 3B3 single chain variant HIV-1 antibody

SCOPe Domain Sequences for d3juyb1:

Sequence; same for both SEQRES and ATOM records:

>d3juyb1 b.1.1.0 (B:1-125) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkkpgasvkvscqasgyrfshftvhwvrqapgqrfewmgwinpyngnkef
sakfqdrvtftadtsantaymelrslrsadtavyycarvgewgwddspydnyymdvwgkg
ttviv

Timeline for d3juyb1:

• d3juyb1 first appeared in SCOPe 2.03
  
• d3juyb1 appears in SCOPe 2.07