Lineage for d3juya1 (3juy A:1-125)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295971Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)
  8. 1296353Domain d3juya1: 3juy A:1-125 [212103]
    automated match to d1dzba1

Details for d3juya1

PDB Entry: 3juy (more details), 2.5 Å

PDB Description: crystal structure of a 3b3 variant, a broadly neutralizing hiv-1 scfv antibody
PDB Compounds: (A:) 3B3 single chain variant HIV-1 antibody

SCOPe Domain Sequences for d3juya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3juya1 b.1.1.0 (A:1-125) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkkpgasvkvscqasgyrfshftvhwvrqapgqrfewmgwinpyngnkef
sakfqdrvtftadtsantaymelrslrsadtavyycarvgewgwddspydnyymdvwgkg
ttviv

SCOPe Domain Coordinates for d3juya1:

Click to download the PDB-style file with coordinates for d3juya1.
(The format of our PDB-style files is described here.)

Timeline for d3juya1: