SCOPe 2.03: Domain d3ju7b_: 3ju7 B:

Lineage for d3ju7b_ (3ju7 B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (66 species)
   not a true protein

7. Species Bacillus cereus [TaxId:222523] [225780] (1 PDB entry)

8. Domain d3ju7b_: 3ju7 B: [212102]
   automated match to d1o69a_
   complexed with act, ca, peg, pge

Details for d3ju7b_

PDB Entry: 3ju7, 2.19 Å

PDB Description: crystal structure of putative plp-dependent aminotransferase (np_978343.1) from bacillus cereus atcc 10987 at 2.19 a resolution

PDB Compounds: (B:) Putative PLP-dependent aminotransferase

SCOPe Domain Sequences for d3ju7b_:

Sequence; same for both SEQRES and ATOM records:

>d3ju7b_ c.67.1.0 (B:) automated matches {Bacillus cereus [TaxId: 222523]}
enipflrastvpvieyldelkeidashiytnygpinqrfeqtimsgffqnrgavttvana
tlglmaaiqlkkrkkgkyalmpsftfpatplaaiwcglepyfidisiddwymdktvlwdk
ieelkeevaivvpyatfgswmnleeyeelekkgvpvvvdaapgfglmnggmhygqdfsgm
iiysfhatkpfgigeggliyskneediqrikrmgnfgfdtnrectmmgfnckmseyaaai
giatmkkwddklkertrisewykqllqsnglmkkgwqlqkteaviqqfmpilcpeevrnk
qviedlkkqkiearlyfspschqqvlfrnykstdltrtnkiakrivslplwegmtkeive
qiviclgq

Timeline for d3ju7b_:

• d3ju7b_ is new in SCOPe 2.03-stable
  
• d3ju7b_ appears in SCOPe 2.04
  
• d3ju7b_ appears in the current release, SCOPe 2.08