![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody |
![]() | Domain d1d5il2: 1d5i L:108-211 [21210] Other proteins in same PDB: d1d5ih1, d1d5ih2, d1d5ih3, d1d5il1 part of humanized oxy-cope catalytic Fab az-28 complexed with cd |
PDB Entry: 1d5i (more details), 2 Å
SCOPe Domain Sequences for d1d5il2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d5il2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr
Timeline for d1d5il2: