Lineage for d3ju5c2 (3ju5 C:94-370)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538320Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2538321Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2538454Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins)
    automatically mapped to Pfam PF00217
  6. 2538455Protein Arginine kinase, C-terminal domain [55942] (2 species)
  7. 2538456Species Apostichopus japonicus [TaxId:307972] [226827] (2 PDB entries)
  8. 2538459Domain d3ju5c2: 3ju5 C:94-370 [212090]
    Other proteins in same PDB: d3ju5a1, d3ju5b1, d3ju5c1, d3ju5d1
    automated match to d1g0wa2
    complexed with mg

Details for d3ju5c2

PDB Entry: 3ju5 (more details), 1.75 Å

PDB Description: Crystal Structure of Dimeric Arginine Kinase at 1.75-A Resolution
PDB Compounds: (C:) arginine kinase

SCOPe Domain Sequences for d3ju5c2:

Sequence, based on SEQRES records: (download)

>d3ju5c2 d.128.1.2 (C:94-370) Arginine kinase, C-terminal domain {Apostichopus japonicus [TaxId: 307972]}
tdnhktdldaskilddvldpayvissrvrtgrnirgmalsphvcrserraiekmvsealn
slaadlkgkyyslmkmdektqqqliddhflfdrpvsrhftsggmardfpdgrgiwhndkk
nflvwineedhtriismqmggnmkevferftrgltevekhikdktgkefmkndhlgfvlt
cpsnlgtgvrcsvhaklphmakdkrfeeictkmrlqkrgtsgeftesvggvydisnldrl
gsseveqvncvikgvkvliemekklekgesiddlvpk

Sequence, based on observed residues (ATOM records): (download)

>d3ju5c2 d.128.1.2 (C:94-370) Arginine kinase, C-terminal domain {Apostichopus japonicus [TaxId: 307972]}
tdnhktdldaskilddvldpayvissrvrtgrnirgmalsphvcrserraiekmvsealn
slaadlkgkyyslmkmdektqqqliddhflfdrpvsrhftsggmardfpdgrgiwhndkk
nflvwineedhtriismqmggnmkevferftrgltevekhikdktgkefmkndhlgfvlt
cpsnlgtgvrcsvhaklphmakdkrfeeictkmrlqkrgtsgtesvggvydisnldrlgs
seveqvncvikgvkvliemekklekgesiddlvpk

SCOPe Domain Coordinates for d3ju5c2:

Click to download the PDB-style file with coordinates for d3ju5c2.
(The format of our PDB-style files is described here.)

Timeline for d3ju5c2: