Lineage for d3ju5c1 (3ju5 C:2-93)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327582Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 2327583Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) (S)
    automatically mapped to Pfam PF02807
  5. 2327584Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 protein domains)
  6. 2327585Protein Arginine kinase, N-domain [48042] (2 species)
  7. 2327586Species Apostichopus japonicus [TaxId:307972] [226828] (2 PDB entries)
  8. 2327589Domain d3ju5c1: 3ju5 C:2-93 [212089]
    Other proteins in same PDB: d3ju5a2, d3ju5b2, d3ju5c2, d3ju5d2
    automated match to d1g0wa1
    complexed with mg

Details for d3ju5c1

PDB Entry: 3ju5 (more details), 1.75 Å

PDB Description: Crystal Structure of Dimeric Arginine Kinase at 1.75-A Resolution
PDB Compounds: (C:) arginine kinase

SCOPe Domain Sequences for d3ju5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ju5c1 a.83.1.1 (C:2-93) Arginine kinase, N-domain {Apostichopus japonicus [TaxId: 307972]}
anlnqkkypakddfpnfeghksllskyltadmyaklrdvatpsgytldraiqngvdnpdf
hlgllagdeetytvfadlfdpvieeyhngfkk

SCOPe Domain Coordinates for d3ju5c1:

Click to download the PDB-style file with coordinates for d3ju5c1.
(The format of our PDB-style files is described here.)

Timeline for d3ju5c1: