SCOPe 2.08: Domain d3ju5c1: 3ju5 C:2-93

Lineage for d3ju5c1 (3ju5 C:2-93)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families)
   automatically mapped to Pfam PF02807

5. Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)

6. Protein Arginine kinase, N-domain [48042] (2 species)

7. Species Apostichopus japonicus [TaxId:307972] [226828] (2 PDB entries)

8. Domain d3ju5c1: 3ju5 C:2-93 [212089]
   Other proteins in same PDB: d3ju5a2, d3ju5b2, d3ju5c2, d3ju5d2
   automated match to d1g0wa1
   complexed with mg

Details for d3ju5c1

PDB Entry: 3ju5, 1.75 Å

PDB Description: Crystal Structure of Dimeric Arginine Kinase at 1.75-A Resolution

PDB Compounds: (C:) arginine kinase

SCOPe Domain Sequences for d3ju5c1:

Sequence; same for both SEQRES and ATOM records:

>d3ju5c1 a.83.1.1 (C:2-93) Arginine kinase, N-domain {Apostichopus japonicus [TaxId: 307972]}
anlnqkkypakddfpnfeghksllskyltadmyaklrdvatpsgytldraiqngvdnpdf
hlgllagdeetytvfadlfdpvieeyhngfkk

Timeline for d3ju5c1:

• d3ju5c1 first appeared in SCOPe 2.03
  
• d3ju5c1 appears in SCOPe 2.07