![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
![]() | Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) ![]() automatically mapped to Pfam PF02807 |
![]() | Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins) |
![]() | Protein Arginine kinase, N-domain [48042] (2 species) |
![]() | Species Apostichopus japonicus [TaxId:307972] [226828] (2 PDB entries) |
![]() | Domain d3ju5c1: 3ju5 C:2-93 [212089] Other proteins in same PDB: d3ju5a2, d3ju5b2, d3ju5c2, d3ju5d2 automated match to d1g0wa1 complexed with mg |
PDB Entry: 3ju5 (more details), 1.75 Å
SCOPe Domain Sequences for d3ju5c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ju5c1 a.83.1.1 (C:2-93) Arginine kinase, N-domain {Apostichopus japonicus [TaxId: 307972]} anlnqkkypakddfpnfeghksllskyltadmyaklrdvatpsgytldraiqngvdnpdf hlgllagdeetytvfadlfdpvieeyhngfkk
Timeline for d3ju5c1: