Lineage for d3ju5b1 (3ju5 B:2-93)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719234Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 2719235Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) (S)
    automatically mapped to Pfam PF02807
  5. 2719236Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)
  6. 2719237Protein Arginine kinase, N-domain [48042] (2 species)
  7. 2719238Species Apostichopus japonicus [TaxId:307972] [226828] (2 PDB entries)
  8. 2719240Domain d3ju5b1: 3ju5 B:2-93 [212087]
    Other proteins in same PDB: d3ju5a2, d3ju5b2, d3ju5c2, d3ju5d2
    automated match to d1g0wa1
    complexed with mg

Details for d3ju5b1

PDB Entry: 3ju5 (more details), 1.75 Å

PDB Description: Crystal Structure of Dimeric Arginine Kinase at 1.75-A Resolution
PDB Compounds: (B:) arginine kinase

SCOPe Domain Sequences for d3ju5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ju5b1 a.83.1.1 (B:2-93) Arginine kinase, N-domain {Apostichopus japonicus [TaxId: 307972]}
anlnqkkypakddfpnfeghksllskyltadmyaklrdvatpsgytldraiqngvdnpdf
hlgllagdeetytvfadlfdpvieeyhngfkk

SCOPe Domain Coordinates for d3ju5b1:

Click to download the PDB-style file with coordinates for d3ju5b1.
(The format of our PDB-style files is described here.)

Timeline for d3ju5b1: