Lineage for d1aqkl2 (1aqk L:112-216)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 454411Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 454415Species Human (Homo sapiens) [TaxId:9606] [88572] (42 PDB entries)
  8. 454420Domain d1aqkl2: 1aqk L:112-216 [21208]
    Other proteins in same PDB: d1aqkh1, d1aqkh2, d1aqkl1
    part of Fab B7-15A2

Details for d1aqkl2

PDB Entry: 1aqk (more details), 1.84 Å

PDB Description: three-dimensional structure of a human fab with high affinity for tetanus toxoid

SCOP Domain Sequences for d1aqkl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqkl2 b.1.1.2 (L:112-216) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens)}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvnagvettkpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvapaecs

SCOP Domain Coordinates for d1aqkl2:

Click to download the PDB-style file with coordinates for d1aqkl2.
(The format of our PDB-style files is described here.)

Timeline for d1aqkl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aqkl1