Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (68 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [225713] (14 PDB entries) |
Domain d3jspa1: 3jsp A:2-70 [212076] Other proteins in same PDB: d3jspa2, d3jspb2 automated match to d1jhfa1 protein/DNA complex |
PDB Entry: 3jsp (more details), 2.9 Å
SCOPe Domain Sequences for d3jspa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jspa1 a.4.5.0 (A:2-70) automated matches {Escherichia coli K-12 [TaxId: 83333]} kaltarqqevfdlirdhisqtgmpptraeiaqrlgfrspnaaeehlkalarkgvieivsg asrgirllq
Timeline for d3jspa1: