SCOPe 2.03: Domain d3jspa1: 3jsp A:2-70

Lineage for d3jspa1 (3jsp A:2-70)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (41 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [225713] (13 PDB entries)

8. Domain d3jspa1: 3jsp A:2-70 [212076]
   Other proteins in same PDB: d3jspa2, d3jspb2
   automated match to d1jhfa1
   protein/DNA complex

Details for d3jspa1

PDB Entry: 3jsp, 2.9 Å

PDB Description: classic protein with a new twist: crystal structure of a lexa repressor dna complex

PDB Compounds: (A:) lexa repressor

SCOPe Domain Sequences for d3jspa1:

Sequence; same for both SEQRES and ATOM records:

>d3jspa1 a.4.5.0 (A:2-70) automated matches {Escherichia coli [TaxId: 83333]}
kaltarqqevfdlirdhisqtgmpptraeiaqrlgfrspnaaeehlkalarkgvieivsg
asrgirllq

Timeline for d3jspa1:

• d3jspa1 is new in SCOPe 2.03-stable
  
• d3jspa1 appears in SCOPe 2.04
  
• d3jspa1 appears in the current release, SCOPe 2.08