| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (92 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [225713] (14 PDB entries) |
| Domain d3jsoa1: 3jso A:2-69 [212072] Other proteins in same PDB: d3jsoa2, d3jsob2 automated match to d1jhfa1 protein/DNA complex |
PDB Entry: 3jso (more details), 2.29 Å
SCOPe Domain Sequences for d3jsoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jsoa1 a.4.5.0 (A:2-69) automated matches {Escherichia coli K-12 [TaxId: 83333]}
kaltarqqevfdlirdhisqtgmpptraeiaqrlgfrspnaaeehlkalarkgvieivsg
asrgirll
Timeline for d3jsoa1: