Lineage for d2h1ph2 (2h1p H:421-520)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289100Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 289192Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries)
  8. 289313Domain d2h1ph2: 2h1p H:421-520 [21207]
    Other proteins in same PDB: d2h1ph1, d2h1pl1, d2h1pl2
    part of polysaccharide binding antibody 2H1P

Details for d2h1ph2

PDB Entry: 2h1p (more details), 2.4 Å

PDB Description: the three-dimensional structures of a polysaccharide binding antibody to cryptococcus neoformans and its complex with a peptide from a phage display library: implications for the identification of peptide mimotopes
PDB Compounds: (H:)

SCOP Domain Sequences for d2h1ph2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h1ph2 b.1.1.2 (H:421-520) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d2h1ph2:

Click to download the PDB-style file with coordinates for d2h1ph2.
(The format of our PDB-style files is described here.)

Timeline for d2h1ph2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h1ph1