Lineage for d3js4a1 (3js4 A:0-89)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1718782Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1719057Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1719324Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 1719325Protein automated matches [226859] (31 species)
    not a true protein
  7. 1719344Species Anaplasma phagocytophilum [TaxId:212042] [225757] (1 PDB entry)
  8. 1719345Domain d3js4a1: 3js4 A:0-89 [212064]
    Other proteins in same PDB: d3js4a2, d3js4b2, d3js4c2, d3js4d2
    automated match to d1unfx1
    complexed with fe, na

Details for d3js4a1

PDB Entry: 3js4 (more details), 1.95 Å

PDB Description: crystal structure of iron superoxide dismutase from anaplasma phagocytophilum
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d3js4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3js4a1 a.2.11.0 (A:0-89) automated matches {Anaplasma phagocytophilum [TaxId: 212042]}
smfelsdlpyeglepyisshlldrhynghhktyvdvlnklvvgtefeglgneslgdivvk
ahnsgsagraifnnaaqiwnhdfywqsmkp

SCOPe Domain Coordinates for d3js4a1:

Click to download the PDB-style file with coordinates for d3js4a1.
(The format of our PDB-style files is described here.)

Timeline for d3js4a1: