SCOPe 2.03: Domain d3jr7a_: 3jr7 A:

Lineage for d3jr7a_ (3jr7 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
   2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]

4. Superfamily c.119.1: DAK1/DegV-like [82549] (3 families)
   domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different

5. Family c.119.1.0: automated matches [191443] (1 protein)
   not a true family

6. Protein automated matches [190655] (7 species)
   not a true protein

7. Species Ruminococcus gnavus [TaxId:411470] [225774] (1 PDB entry)

8. Domain d3jr7a_: 3jr7 A: [212056]
   automated match to d2g7za_
   complexed with na, pg6, po4

Details for d3jr7a_

PDB Entry: 3jr7, 2 Å

PDB Description: The crystal structure of the protein of DegV family COG1307 with unknown function from Ruminococcus gnavus ATCC 29149

PDB Compounds: (A:) uncharacterized egV family protein COG1307

SCOPe Domain Sequences for d3jr7a_:

Sequence, based on SEQRES records:

>d3jr7a_ c.119.1.0 (A:) automated matches {Ruminococcus gnavus [TaxId: 411470]}
kdmsykvivdscgeftpemkadggfehvalgiqiedtqwtdddslkqeelllkiaestsc
aktscpsperymesyhcdaeriyvvtlsaelsgsynsavlgknlyeeeygekqihvfnsr
sasvgetlialkvqqcekagmtfeevvesvecyieeqhtyfvlenldtlrkngrltgiks
lvagalnikpimgstpqgticqkekargmkkalvkmadcvaadvvnagdkilaiahcnce
erakevqrllkerfavkssfivdtsgistvyandggiivvv

Sequence, based on observed residues (ATOM records):

>d3jr7a_ c.119.1.0 (A:) automated matches {Ruminococcus gnavus [TaxId: 411470]}
kdmsykvivdscgeftpemkadggfehvalgiqiedtqwtdddslkqeelllkiaestsc
aktscpsperymesyhcdaeriyvvtlsaelsgsynsavlgknlyeeeygekqihvfnsr
sasvgetlialkvqqcekagmtfeevvesvecyieeqhtyfvlenldtlrkngrltgiks
agalnikpimgstpqgticqkekargmkkalvkmadcvaadvvnagdkilaiahcnceer
akevqrllkerfavkssfivdtsgistvyandggiivvv

Timeline for d3jr7a_:

• d3jr7a_ is new in SCOPe 2.03-stable
  
• d3jr7a_ appears in SCOPe 2.04
  
• d3jr7a_ appears in the current release, SCOPe 2.08