Lineage for d3jr7a_ (3jr7 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921751Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
    2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]
  4. 2921752Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) (S)
    domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different
  5. 2921799Family c.119.1.0: automated matches [191443] (1 protein)
    not a true family
  6. 2921800Protein automated matches [190655] (13 species)
    not a true protein
  7. 2921824Species Ruminococcus gnavus [TaxId:411470] [225774] (2 PDB entries)
  8. 2921825Domain d3jr7a_: 3jr7 A: [212056]
    automated match to d2g7za_
    complexed with na, pg6, po4

Details for d3jr7a_

PDB Entry: 3jr7 (more details), 2 Å

PDB Description: The crystal structure of the protein of DegV family COG1307 with unknown function from Ruminococcus gnavus ATCC 29149
PDB Compounds: (A:) uncharacterized egV family protein COG1307

SCOPe Domain Sequences for d3jr7a_:

Sequence, based on SEQRES records: (download)

>d3jr7a_ c.119.1.0 (A:) automated matches {Ruminococcus gnavus [TaxId: 411470]}
kdmsykvivdscgeftpemkadggfehvalgiqiedtqwtdddslkqeelllkiaestsc
aktscpsperymesyhcdaeriyvvtlsaelsgsynsavlgknlyeeeygekqihvfnsr
sasvgetlialkvqqcekagmtfeevvesvecyieeqhtyfvlenldtlrkngrltgiks
lvagalnikpimgstpqgticqkekargmkkalvkmadcvaadvvnagdkilaiahcnce
erakevqrllkerfavkssfivdtsgistvyandggiivvv

Sequence, based on observed residues (ATOM records): (download)

>d3jr7a_ c.119.1.0 (A:) automated matches {Ruminococcus gnavus [TaxId: 411470]}
kdmsykvivdscgeftpemkadggfehvalgiqiedtqwtdddslkqeelllkiaestsc
aktscpsperymesyhcdaeriyvvtlsaelsgsynsavlgknlyeeeygekqihvfnsr
sasvgetlialkvqqcekagmtfeevvesvecyieeqhtyfvlenldtlrkngrltgiks
agalnikpimgstpqgticqkekargmkkalvkmadcvaadvvnagdkilaiahcnceer
akevqrllkerfavkssfivdtsgistvyandggiivvv

SCOPe Domain Coordinates for d3jr7a_:

Click to download the PDB-style file with coordinates for d3jr7a_.
(The format of our PDB-style files is described here.)

Timeline for d3jr7a_: