| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
| Species Fab H57 (hamster), lambda L chain [49050] (1 PDB entry) |
| Domain d1nfdh2: 1nfd H:115-228 [21205] Other proteins in same PDB: d1nfda1, d1nfda2, d1nfdb1, d1nfdb2, d1nfdc1, d1nfdc2, d1nfdd1, d1nfdd2, d1nfde1, d1nfdf1, d1nfdg1, d1nfdh1 complexed with nag |
PDB Entry: 1nfd (more details), 2.8 Å
SCOP Domain Sequences for d1nfdh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nfdh2 b.1.1.2 (H:115-228) Immunoglobulin (constant domains of L and H chains) {Fab H57 (hamster), lambda L chain}
tttapsvyplapacdsttsttdtvtlgclvkgyfpepvtvswnsgaltsgvhtfpsvlhs
glyslsssvtvpsstwpkqpitcnvahpasstkvdkkiepr
Timeline for d1nfdh2: