Lineage for d3jqeb_ (3jqe B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2096341Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226760] (20 PDB entries)
  8. 2096371Domain d3jqeb_: 3jqe B: [212045]
    automated match to d1p33a_
    complexed with act, dx8, nap

Details for d3jqeb_

PDB Entry: 3jqe (more details), 2 Å

PDB Description: crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 2- amino-6-(4-methoxyphenyl)-4-oxo-4,7-dihydro-3h-pyrrolo[2,3- d]pyrimidine-5-carbonitrile (dx8)
PDB Compounds: (B:) pteridine reductase 1

SCOPe Domain Sequences for d3jqeb_:

Sequence, based on SEQRES records: (download)

>d3jqeb_ c.2.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqva
eligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkhal
vgltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadav
iflvsgsaqyitgsiikvdgglslvha

Sequence, based on observed residues (ATOM records): (download)

>d3jqeb_ c.2.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvgktvetqvaeligtnaia
pflltmsfaqrqnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirvn
gvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvd
gglslvha

SCOPe Domain Coordinates for d3jqeb_:

Click to download the PDB-style file with coordinates for d3jqeb_.
(The format of our PDB-style files is described here.)

Timeline for d3jqeb_: