Lineage for d3jq7c_ (3jq7 C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2109198Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226760] (20 PDB entries)
  8. 2109213Domain d3jq7c_: 3jq7 C: [212018]
    automated match to d1p33a_
    complexed with act, dtt, dx2, nap

Details for d3jq7c_

PDB Entry: 3jq7 (more details), 1.8 Å

PDB Description: Crystal structure of pteridine reductase 1 (PTR1) from Trypanosoma brucei in ternary complex with cofactor (NADP+) and inhibitor 6-phenylpteridine-2,4,7-triamine (DX2)
PDB Compounds: (C:) pteridine reductase 1

SCOPe Domain Sequences for d3jq7c_:

Sequence, based on SEQRES records: (download)

>d3jq7c_ c.2.1.0 (C:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
apaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqad
ltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqvae
ligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkhalv
gltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadavi
flvsgsaqyitgsiikvdgglslvha

Sequence, based on observed residues (ATOM records): (download)

>d3jq7c_ c.2.1.0 (C:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
apaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqad
ltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvgktvetqvaeligtnaiap
flltmsfaqrqnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirvng
vapgvsllpdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvdgglslvha

SCOPe Domain Coordinates for d3jq7c_:

Click to download the PDB-style file with coordinates for d3jq7c_.
(The format of our PDB-style files is described here.)

Timeline for d3jq7c_: