SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3jq6a_ (3jq6 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (220 species)
    not a true protein
  7. 2096341Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226760] (15 PDB entries)
  8. 2096350Domain d3jq6a_: 3jq6 A: [212012]
    automated match to d1p33a_
    complexed with dtt, dx1, nap

Details for d3jq6a_

PDB Entry: 3jq6 (more details), 1.8 Å

PDB Description: Crystal structure of pteridine reductase 1 (PTR1) from Trypanosoma brucei in ternary complex with cofactor (NADP+) and inhibitor 6,7-bis(1-methylethyl)pteridine-2,4-diamine (DX1)
PDB Compounds: (A:) pteridine reductase 1

SCOPe Domain Sequences for d3jq6a_:

Sequence, based on SEQRES records: (download)

>d3jq6a_ c.2.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqva
eligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkhal
vgltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadav
iflvsgsaqyitgsiikvdgglslvha

Sequence, based on observed residues (ATOM records): (download)

>d3jq6a_ c.2.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvgktvetqvaeligtnaia
pflltmsfaqrqsnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirv
ngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikv
dgglslvha

SCOPe Domain Coordinates for d3jq6a_:

Click to download the PDB-style file with coordinates for d3jq6a_.
(The format of our PDB-style files is described here.)

Timeline for d3jq6a_: