Lineage for d3jq3a2 (3jq3 A:90-366)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214217Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2214218Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2214486Family d.128.1.0: automated matches [227250] (1 protein)
    not a true family
  6. 2214487Protein automated matches [227028] (5 species)
    not a true protein
  7. 2214549Species Innkeeper worm (Urechis caupo) [TaxId:6431] [225964] (2 PDB entries)
  8. 2214552Domain d3jq3a2: 3jq3 A:90-366 [212011]
    Other proteins in same PDB: d3jq3a1
    automated match to d1g0wa2
    complexed with adp

Details for d3jq3a2

PDB Entry: 3jq3 (more details), 2.5 Å

PDB Description: crystal structure of lombricine kinase, complexed with substrate adp
PDB Compounds: (A:) Lombricine kinase

SCOPe Domain Sequences for d3jq3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jq3a2 d.128.1.0 (A:90-366) automated matches {Innkeeper worm (Urechis caupo) [TaxId: 6431]}
ndsqpapdldasklvggqfdekyvkscrirtgrgirglcyppsctrgerrevervittal
aglsgdlsgtyyplskmtpeqenqliadhflfqkptghlmvnsasvrdwpdargiwhnne
ktfliwineedhmrvismqkggnvkavferfgrglnaiaeqmkkngreymwnqrlgylca
cpsnlgtglrasvhvqlhqlskhpkfedivvalqlqkrgtggehtaavddvydisnaarl
kkserefvqllidgvkklidmeqaleagksiddlipa

SCOPe Domain Coordinates for d3jq3a2:

Click to download the PDB-style file with coordinates for d3jq3a2.
(The format of our PDB-style files is described here.)

Timeline for d3jq3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3jq3a1