![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
![]() | Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) ![]() |
![]() | Family d.128.1.0: automated matches [227250] (1 protein) not a true family |
![]() | Protein automated matches [227028] (5 species) not a true protein |
![]() | Species Innkeeper worm (Urechis caupo) [TaxId:6431] [225964] (2 PDB entries) |
![]() | Domain d3jq3a2: 3jq3 A:90-366 [212011] Other proteins in same PDB: d3jq3a1 automated match to d1g0wa2 complexed with adp |
PDB Entry: 3jq3 (more details), 2.5 Å
SCOPe Domain Sequences for d3jq3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jq3a2 d.128.1.0 (A:90-366) automated matches {Innkeeper worm (Urechis caupo) [TaxId: 6431]} ndsqpapdldasklvggqfdekyvkscrirtgrgirglcyppsctrgerrevervittal aglsgdlsgtyyplskmtpeqenqliadhflfqkptghlmvnsasvrdwpdargiwhnne ktfliwineedhmrvismqkggnvkavferfgrglnaiaeqmkkngreymwnqrlgylca cpsnlgtglrasvhvqlhqlskhpkfedivvalqlqkrgtggehtaavddvydisnaarl kkserefvqllidgvkklidmeqaleagksiddlipa
Timeline for d3jq3a2: