SCOPe 2.08: Domain d3jq3a2: 3jq3 A:90-366

Lineage for d3jq3a2 (3jq3 A:90-366)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
   duplication: common core consists of two beta-alpha-beta2-alpha repeats

4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families)

5. Family d.128.1.0: automated matches [227250] (1 protein)
   not a true family

6. Protein automated matches [227028] (6 species)
   not a true protein

7. Species Innkeeper worm (Urechis caupo) [TaxId:6431] [225964] (2 PDB entries)

8. Domain d3jq3a2: 3jq3 A:90-366 [212011]
   Other proteins in same PDB: d3jq3a1
   automated match to d1g0wa2
   complexed with adp

Details for d3jq3a2

PDB Entry: 3jq3, 2.5 Å

PDB Description: crystal structure of lombricine kinase, complexed with substrate adp

PDB Compounds: (A:) Lombricine kinase

SCOPe Domain Sequences for d3jq3a2:

Sequence; same for both SEQRES and ATOM records:

>d3jq3a2 d.128.1.0 (A:90-366) automated matches {Innkeeper worm (Urechis caupo) [TaxId: 6431]}
ndsqpapdldasklvggqfdekyvkscrirtgrgirglcyppsctrgerrevervittal
aglsgdlsgtyyplskmtpeqenqliadhflfqkptghlmvnsasvrdwpdargiwhnne
ktfliwineedhmrvismqkggnvkavferfgrglnaiaeqmkkngreymwnqrlgylca
cpsnlgtglrasvhvqlhqlskhpkfedivvalqlqkrgtggehtaavddvydisnaarl
kkserefvqllidgvkklidmeqaleagksiddlipa

Timeline for d3jq3a2:

• d3jq3a2 first appeared in SCOPe 2.03
  
• d3jq3a2 appears in SCOPe 2.07