| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) ![]() automatically mapped to Pfam PF02807 |
| Family a.83.1.0: automated matches [227170] (1 protein) not a true family |
| Protein automated matches [226884] (9 species) not a true protein |
| Species Innkeeper worm (Urechis caupo) [TaxId:6431] [225963] (2 PDB entries) |
| Domain d3jq3a1: 3jq3 A:3-89 [212010] Other proteins in same PDB: d3jq3a2 automated match to d1g0wa1 complexed with adp |
PDB Entry: 3jq3 (more details), 2.5 Å
SCOPe Domain Sequences for d3jq3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jq3a1 a.83.1.0 (A:3-89) automated matches {Innkeeper worm (Urechis caupo) [TaxId: 6431]}
fqndakanfpdyanhgcvvgrhlnfemyqrlfgkktahgvtvdkviqpsvdnfgncigli
agdeesyevfkelfdavinekhkgfgp
Timeline for d3jq3a1: