SCOPe 2.06: Domain d3jpzb2: 3jpz B:90-364

Lineage for d3jpzb2 (3jpz B:90-364)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
   duplication: common core consists of two beta-alpha-beta2-alpha repeats

4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families)

5. Family d.128.1.0: automated matches [227250] (1 protein)
   not a true family

6. Protein automated matches [227028] (5 species)
   not a true protein

7. Species Innkeeper worm (Urechis caupo) [TaxId:6431] [225964] (2 PDB entries)

8. Domain d3jpzb2: 3jpz B:90-364 [212009]
   Other proteins in same PDB: d3jpza1, d3jpzb1
   automated match to d1g0wa2
   complexed with no3

Details for d3jpzb2

PDB Entry: 3jpz, 1.95 Å

PDB Description: crystal structure of lombricine kinase

PDB Compounds: (B:) Lombricine kinase

SCOPe Domain Sequences for d3jpzb2:

Sequence; same for both SEQRES and ATOM records:

>d3jpzb2 d.128.1.0 (B:90-364) automated matches {Innkeeper worm (Urechis caupo) [TaxId: 6431]}
ndsqpapdldasklvggqfdekyvkscrirtgrgirglcyppsctrgerrevervittal
aglsgdlsgtyyplskmtpeqenqliadhflfqkptghlmvnsasvrdwpdargiwhnne
ktfliwineedhmrvismqkggnvkavferfgrglnaiaeqmkkngreymwnqrlgylca
cpsnlgtglrasvhvqlhqlskhpkfedivvalqlqkrgtggehtaavddvydisnaarl
kkserefvqllidgvkklidmeqaleagksiddli

Timeline for d3jpzb2:

• d3jpzb2 first appeared in SCOPe 2.03
  
• d3jpzb2 appears in SCOPe 2.05
  
• d3jpzb2 appears in SCOPe 2.07
  
• d3jpzb2 appears in the current release, SCOPe 2.08