Lineage for d3jpza1 (3jpz A:3-89)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332344Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 2332345Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) (S)
    automatically mapped to Pfam PF02807
  5. 2332410Family a.83.1.0: automated matches [227170] (1 protein)
    not a true family
  6. 2332411Protein automated matches [226884] (9 species)
    not a true protein
  7. 2332433Species Innkeeper worm (Urechis caupo) [TaxId:6431] [225963] (2 PDB entries)
  8. 2332434Domain d3jpza1: 3jpz A:3-89 [212006]
    Other proteins in same PDB: d3jpza2, d3jpzb2
    automated match to d1g0wa1
    complexed with no3

Details for d3jpza1

PDB Entry: 3jpz (more details), 1.95 Å

PDB Description: crystal structure of lombricine kinase
PDB Compounds: (A:) Lombricine kinase

SCOPe Domain Sequences for d3jpza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jpza1 a.83.1.0 (A:3-89) automated matches {Innkeeper worm (Urechis caupo) [TaxId: 6431]}
fqndakanfpdyanhgcvvgrhlnfemyqrlfgkktahgvtvdkviqpsvdnfgncigli
agdeesyevfkelfdavinekhkgfgp

SCOPe Domain Coordinates for d3jpza1:

Click to download the PDB-style file with coordinates for d3jpza1.
(The format of our PDB-style files is described here.)

Timeline for d3jpza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3jpza2