SCOPe 2.08: Domain d3ixra1: 3ixr A:1-158

Lineage for d3ixra1 (3ixr A:1-158)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Xylella fastidiosa [TaxId:2371] [196083] (2 PDB entries)

8. Domain d3ixra1: 3ixr A:1-158 [212000]
   Other proteins in same PDB: d3ixra2
   automated match to d1e2ya_
   mutant

Details for d3ixra1

PDB Entry: 3ixr, 1.6 Å

PDB Description: crystal structure of xylella fastidiosa prxq c47s mutant

PDB Compounds: (A:) bacterioferritin comigratory protein

SCOPe Domain Sequences for d3ixra1:

Sequence, based on SEQRES records:

>d3ixra1 c.47.1.0 (A:1-158) automated matches {Xylella fastidiosa [TaxId: 2371]}
mnigdtlnhsllnhplmlsgstcktlsdytnqwlvlyfypkdntpgssteglefnlllpq
feqinatvlgvsrdsvkshdsfcakqgftfplvsdsdailckafdvikektmygrqvigi
erstfligpthriveawrqvkvpghaeevlnklkahae

Sequence, based on observed residues (ATOM records):

>d3ixra1 c.47.1.0 (A:1-158) automated matches {Xylella fastidiosa [TaxId: 2371]}
mnigdtlnhsllnhplmlsgstcktlsdytnqwlvlyfypkdntpgssteglefnlllpq
feqinatvlgvsrdsvkshdsfcakqgftfplvsdsdailckafdvikektmyqvigier
stfligpthriveawrqvkvpghaeevlnklkahae

Timeline for d3ixra1:

• d3ixra1 first appeared in SCOPe 2.03, called d3ixra_
  
• d3ixra1 appears in SCOPe 2.07