Lineage for d3ixra1 (3ixr A:1-158)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880569Species Xylella fastidiosa [TaxId:2371] [196083] (2 PDB entries)
  8. 2880570Domain d3ixra1: 3ixr A:1-158 [212000]
    Other proteins in same PDB: d3ixra2
    automated match to d1e2ya_
    mutant

Details for d3ixra1

PDB Entry: 3ixr (more details), 1.6 Å

PDB Description: crystal structure of xylella fastidiosa prxq c47s mutant
PDB Compounds: (A:) bacterioferritin comigratory protein

SCOPe Domain Sequences for d3ixra1:

Sequence, based on SEQRES records: (download)

>d3ixra1 c.47.1.0 (A:1-158) automated matches {Xylella fastidiosa [TaxId: 2371]}
mnigdtlnhsllnhplmlsgstcktlsdytnqwlvlyfypkdntpgssteglefnlllpq
feqinatvlgvsrdsvkshdsfcakqgftfplvsdsdailckafdvikektmygrqvigi
erstfligpthriveawrqvkvpghaeevlnklkahae

Sequence, based on observed residues (ATOM records): (download)

>d3ixra1 c.47.1.0 (A:1-158) automated matches {Xylella fastidiosa [TaxId: 2371]}
mnigdtlnhsllnhplmlsgstcktlsdytnqwlvlyfypkdntpgssteglefnlllpq
feqinatvlgvsrdsvkshdsfcakqgftfplvsdsdailckafdvikektmyqvigier
stfligpthriveawrqvkvpghaeevlnklkahae

SCOPe Domain Coordinates for d3ixra1:

Click to download the PDB-style file with coordinates for d3ixra1.
(The format of our PDB-style files is described here.)

Timeline for d3ixra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ixra2