SCOPe 2.05: Domain d3ixca_: 3ixc A:

Lineage for d3ixca_ (3ixc A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (28 species)
   not a true protein

7. Species Anaplasma phagocytophilum [TaxId:212042] [225756] (1 PDB entry)

8. Domain d3ixca_: 3ixc A: [211999]
   automated match to d3r3ra_
   complexed with mg

Details for d3ixca_

PDB Entry: 3ixc, 1.61 Å

PDB Description: Crystal structure of hexapeptide transferase family protein from Anaplasma phagocytophilum

PDB Compounds: (A:) Hexapeptide transferase family protein

SCOPe Domain Sequences for d3ixca_:

Sequence, based on SEQRES records:

>d3ixca_ b.81.1.0 (A:) automated matches {Anaplasma phagocytophilum [TaxId: 212042]}
mrevlvpyagvspsvdstafiagnariigdvcigknasiwygtvlrgdvdkievgegtni
qdntvvhtdsmhgdtvigkfvtighscilhactlgnnafvgmgsivmdravmeegsmlaa
gslltrgkivksgelwagrpakflrmmteeeilylqksaenyialsrgyl

Sequence, based on observed residues (ATOM records):

>d3ixca_ b.81.1.0 (A:) automated matches {Anaplasma phagocytophilum [TaxId: 212042]}
mrevlvpyagvspsvdstafiagnariigdvcigknasiwygtvlrgdvdkievgegtni
qdntvvhtgdtvigkfvtighscilhactlgnnafvgmgsivmdravmeegsmlaagsll
trgkivksgelwagrpakflrmmteeeilylqksaenyialsrgyl

Timeline for d3ixca_:

• d3ixca_ first appeared in SCOPe 2.03
  
• d3ixca_ appears in SCOPe 2.04
  
• d3ixca_ appears in SCOPe 2.06
  
• d3ixca_ appears in the current release, SCOPe 2.08