Lineage for d3ixca_ (3ixc A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069505Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069506Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2069791Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2069792Protein automated matches [190967] (30 species)
    not a true protein
  7. 2069804Species Anaplasma phagocytophilum [TaxId:212042] [225756] (1 PDB entry)
  8. 2069805Domain d3ixca_: 3ixc A: [211999]
    automated match to d3r3ra_
    complexed with mg

Details for d3ixca_

PDB Entry: 3ixc (more details), 1.61 Å

PDB Description: Crystal structure of hexapeptide transferase family protein from Anaplasma phagocytophilum
PDB Compounds: (A:) Hexapeptide transferase family protein

SCOPe Domain Sequences for d3ixca_:

Sequence, based on SEQRES records: (download)

>d3ixca_ b.81.1.0 (A:) automated matches {Anaplasma phagocytophilum [TaxId: 212042]}
mrevlvpyagvspsvdstafiagnariigdvcigknasiwygtvlrgdvdkievgegtni
qdntvvhtdsmhgdtvigkfvtighscilhactlgnnafvgmgsivmdravmeegsmlaa
gslltrgkivksgelwagrpakflrmmteeeilylqksaenyialsrgyl

Sequence, based on observed residues (ATOM records): (download)

>d3ixca_ b.81.1.0 (A:) automated matches {Anaplasma phagocytophilum [TaxId: 212042]}
mrevlvpyagvspsvdstafiagnariigdvcigknasiwygtvlrgdvdkievgegtni
qdntvvhtgdtvigkfvtighscilhactlgnnafvgmgsivmdravmeegsmlaagsll
trgkivksgelwagrpakflrmmteeeilylqksaenyialsrgyl

SCOPe Domain Coordinates for d3ixca_:

Click to download the PDB-style file with coordinates for d3ixca_.
(The format of our PDB-style files is described here.)

Timeline for d3ixca_: