Lineage for d3iwzb2 (3iwz B:159-228)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307971Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307972Protein automated matches [190154] (87 species)
    not a true protein
  7. 2308598Species Xanthomonas campestris [TaxId:340] [225797] (1 PDB entry)
  8. 2308600Domain d3iwzb2: 3iwz B:159-228 [211992]
    Other proteins in same PDB: d3iwza1, d3iwzb1, d3iwzc1, d3iwzd1
    automated match to d2oz6a1

Details for d3iwzb2

PDB Entry: 3iwz (more details), 2.3 Å

PDB Description: the c-di-gmp responsive global regulator clp links cell-cell signaling to virulence gene expression in xanthomonas campestris
PDB Compounds: (B:) Catabolite activation-like protein

SCOPe Domain Sequences for d3iwzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iwzb2 a.4.5.0 (B:159-228) automated matches {Xanthomonas campestris [TaxId: 340]}
dvtdrivrtlhdlskepeamshpqgtqlrvsrqelarlvgcsremagrvlkklqadgllh
argktvvlyg

SCOPe Domain Coordinates for d3iwzb2:

Click to download the PDB-style file with coordinates for d3iwzb2.
(The format of our PDB-style files is described here.)

Timeline for d3iwzb2: