Lineage for d3iwva_ (3iwv A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1772695Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1772955Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 1773528Family b.3.4.0: automated matches [191441] (1 protein)
    not a true family
  6. 1773529Protein automated matches [190651] (7 species)
    not a true protein
  7. 1773562Species Zebrafish (Danio rerio) [TaxId:7955] [187781] (5 PDB entries)
  8. 1773563Domain d3iwva_: 3iwv A: [211985]
    automated match to d3q1eb_
    mutant

Details for d3iwva_

PDB Entry: 3iwv (more details), 1.68 Å

PDB Description: crystal structure of y116t mutant of 5-hydroxyisourate hydrolase (trp)
PDB Compounds: (A:) 5-hydroxyisourate hydrolase

SCOPe Domain Sequences for d3iwva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iwva_ b.3.4.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
splsthvlniaqgvpganmtivlhrldpvssawnilttgitnddgrcpglitkenfiagv
ykmrfetgkywdalgetcfypyveivftitntsqhyhvplllsrfsysttrgs

SCOPe Domain Coordinates for d3iwva_:

Click to download the PDB-style file with coordinates for d3iwva_.
(The format of our PDB-style files is described here.)

Timeline for d3iwva_: