SCOPe 2.05: Domain d3iwue_: 3iwu E:

Lineage for d3iwue_ (3iwu E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.0: automated matches [191441] (1 protein)
   not a true family

6. Protein automated matches [190651] (7 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [187781] (5 PDB entries)

8. Domain d3iwue_: 3iwu E: [211981]
   automated match to d3q1eb_
   mutant

Details for d3iwue_

PDB Entry: 3iwu, 2.3 Å

PDB Description: crystal structure of y116t/i16a double mutant of 5-hydroxyisourate hydrolase

PDB Compounds: (E:) 5-hydroxyisourate hydrolase

SCOPe Domain Sequences for d3iwue_:

Sequence; same for both SEQRES and ATOM records:

>d3iwue_ b.3.4.0 (E:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
lsplsthvlnaaqgvpganmtivlhrldpvssawnilttgitnddgrcpglitkenfiag
vykmrfetgkywdalgetcfypyveivftitntsqhyhvplllsrfsysttrgs

Timeline for d3iwue_:

• d3iwue_ first appeared in SCOPe 2.03
  
• d3iwue_ appears in SCOPe 2.04
  
• d3iwue_ appears in SCOPe 2.06
  
• d3iwue_ appears in the current release, SCOPe 2.08