Lineage for d3iwue_ (3iwu E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768957Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2769733Family b.3.4.0: automated matches [191441] (1 protein)
    not a true family
  6. 2769734Protein automated matches [190651] (8 species)
    not a true protein
  7. 2769790Species Zebrafish (Danio rerio) [TaxId:7955] [187781] (5 PDB entries)
  8. 2769815Domain d3iwue_: 3iwu E: [211981]
    automated match to d3q1eb_
    mutant

Details for d3iwue_

PDB Entry: 3iwu (more details), 2.3 Å

PDB Description: crystal structure of y116t/i16a double mutant of 5-hydroxyisourate hydrolase
PDB Compounds: (E:) 5-hydroxyisourate hydrolase

SCOPe Domain Sequences for d3iwue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iwue_ b.3.4.0 (E:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
lsplsthvlnaaqgvpganmtivlhrldpvssawnilttgitnddgrcpglitkenfiag
vykmrfetgkywdalgetcfypyveivftitntsqhyhvplllsrfsysttrgs

SCOPe Domain Coordinates for d3iwue_:

Click to download the PDB-style file with coordinates for d3iwue_.
(The format of our PDB-style files is described here.)

Timeline for d3iwue_: