Lineage for d1mf2l2 (1mf2 L:108-211)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159828Species Fab F11.2.32 (mouse), kappa L chain [49049] (2 PDB entries)
  8. 159834Domain d1mf2l2: 1mf2 L:108-211 [21198]
    Other proteins in same PDB: d1mf2h1, d1mf2l1, d1mf2m1, d1mf2n1

Details for d1mf2l2

PDB Entry: 1mf2 (more details), 2.6 Å

PDB Description: anti hiv1 protease fab complex

SCOP Domain Sequences for d1mf2l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mf2l2 b.1.1.2 (L:108-211) Immunoglobulin (constant domains of L and H chains) {Fab F11.2.32 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d1mf2l2:

Click to download the PDB-style file with coordinates for d1mf2l2.
(The format of our PDB-style files is described here.)

Timeline for d1mf2l2: