SCOPe 2.05: Domain d3ivaa3: 3iva A:901-1226

Lineage for d3ivaa3 (3iva A:901-1226)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.173: Methionine synthase activation domain-like [56506] (1 superfamily)
   unusual fold; core: beta-alpha(2)-beta(2)-alpha(2)-beta-alpha-beta; antiparallel beta-sheet: order 12354

4. Superfamily d.173.1: Methionine synthase activation domain-like [56507] (3 families)

5. Family d.173.1.1: Methionine synthase SAM-binding domain [56508] (1 protein)

6. Protein Methionine synthase SAM-binding domain [56509] (1 species)

7. Species Escherichia coli [TaxId:562] [56510] (5 PDB entries)

8. Domain d3ivaa3: 3iva A:901-1226 [211972]
   Other proteins in same PDB: d3ivaa1, d3ivaa2
   automated match to d3bula3
   complexed with b12, no3, sah

Details for d3ivaa3

PDB Entry: 3iva, 2.7 Å

PDB Description: structure of the b12-dependent methionine synthase (meth) c-teminal half with adohcy bound

PDB Compounds: (A:) methionine synthase

SCOPe Domain Sequences for d3ivaa3:

Sequence; same for both SEQRES and ATOM records:

>d3ivaa3 d.173.1.1 (A:901-1226) Methionine synthase SAM-binding domain {Escherichia coli [TaxId: 562]}
tppvtleaardndfafdwqaytppvahrlgvqeveasietlrnyidwtpffmtwslagky
priledevvgveaqrlfkdandmldklsaektlnprgvvglfpanrvgddieiyrdetrt
hvinvshhlrqqtektgfanycladfvapklsgkadyigafavtggleedaladafeaqh
ddynkimvkaladrlaeafaeylhervrkvywgyapnenlsneelirenyqgirpapgyp
acpehtekatiwellevekhtgmkltesfamwpgasvsgwyfshpdskyyavaqiqrdqv
edyarrkgmsvteverwlapnlgyda

Timeline for d3ivaa3:

• d3ivaa3 first appeared in SCOPe 2.03
  
• d3ivaa3 appears in SCOPe 2.04
  
• d3ivaa3 appears in SCOPe 2.06
  
• d3ivaa3 appears in the current release, SCOPe 2.08