SCOPe 2.08: Domain d3iuyb1: 3iuy B:213-439

Lineage for d3iuyb1 (3iuy B:213-439)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)

8. Domain d3iuyb1: 3iuy B:213-439 [211967]
   Other proteins in same PDB: d3iuya2, d3iuyb2
   automated match to d1t6na_
   complexed with amp, cl

Details for d3iuyb1

PDB Entry: 3iuy, 2.4 Å

PDB Description: crystal structure of ddx53 dead-box domain

PDB Compounds: (B:) Probable ATP-dependent RNA helicase DDX53

SCOPe Domain Sequences for d3iuyb1:

Sequence, based on SEQRES records:

>d3iuyb1 c.37.1.0 (B:213-439) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tcddlksgekrlipkptcrfkdafqqypdllksiirvgilkptpiqsqawpiilqgidli
vvaqtgtgktlsylmpgfihldsqpisreqrngpgmlvltptrelalhveaecskysykg
lksiciyggrnrngqiediskgvdiiiatpgrlndlqmnnsvnlrsitylvideadkmld
mefepqirkilldvrpdrqtvmtsatwpdtvrqlalsylkdpmivyv

Sequence, based on observed residues (ATOM records):

>d3iuyb1 c.37.1.0 (B:213-439) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tcddlksgekrlipkptcrfkdafqqypdllksiirvgilkptpiqsqawpiilqgidli
vvaqtgtgktlsylmpgfihldsngpgmlvltptrelalhveaecskysykglksiciyg
vdiiiatpgrlndlqmnnsvnlrsitylvideadkmldmefepqirkilldvrpdrqtvm
tsatwpdtvrqlalsylkdpmivyv

Timeline for d3iuyb1:

• d3iuyb1 first appeared in SCOPe 2.03, called d3iuyb_
  
• d3iuyb1 appears in SCOPe 2.07