SCOPe 2.05: Domain d3iucc2: 3iuc C:216-408

Lineage for d3iucc2 (3iuc C:216-408)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (49 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224896] (42 PDB entries)

8. Domain d3iucc2: 3iuc C:216-408 [211965]
   automated match to d1ngfa2
   complexed with adp, ca

Details for d3iucc2

PDB Entry: 3iuc, 2.4 Å

PDB Description: Crystal structure of the human 70kDa heat shock protein 5 (BiP/GRP78) ATPase domain in complex with ADP

PDB Compounds: (C:) Heat shock 70kDa protein 5 (Glucose-regulated protein, 78kDa)

SCOPe Domain Sequences for d3iucc2:

Sequence; same for both SEQRES and ATOM records:

>d3iucc2 c.55.1.0 (C:216-408) automated matches {Human (Homo sapiens) [TaxId: 9606]}
geknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmehfiklykkktg
kdvrkdnravqklrrevekakralssqhqarieiesfyegedfsetltrakfeelnmdlf
rstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkepsrginpdeava
ygaavqagvlsgd

Timeline for d3iucc2:

• d3iucc2 first appeared in SCOPe 2.03
  
• d3iucc2 appears in SCOPe 2.04
  
• d3iucc2 appears in SCOPe 2.06
  
• d3iucc2 appears in the current release, SCOPe 2.08