![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (35 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [224896] (31 PDB entries) |
![]() | Domain d3iuca2: 3iuc A:215-406 [211963] automated match to d1ngfa2 complexed with adp, ca |
PDB Entry: 3iuc (more details), 2.4 Å
SCOPe Domain Sequences for d3iuca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iuca2 c.55.1.0 (A:215-406) automated matches {Human (Homo sapiens) [TaxId: 9606]} egeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmehfiklykkkt gkdvrkdnravqklrrevekakralssqhqarieiesfyegedfsetltrakfeelnmdl frstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkepsrginpdeav aygaavqagvls
Timeline for d3iuca2: