Lineage for d2hrpm2 (2hrp M:108-214)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53770Species Fab F11.2.32 (mouse), kappa L chain [49049] (2 PDB entries)
  8. 53773Domain d2hrpm2: 2hrp M:108-214 [21196]
    Other proteins in same PDB: d2hrph1, d2hrpl1, d2hrpm1, d2hrpn1

Details for d2hrpm2

PDB Entry: 2hrp (more details), 2.2 Å

PDB Description: antigen-antibody complex

SCOP Domain Sequences for d2hrpm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hrpm2 b.1.1.2 (M:108-214) Immunoglobulin (constant domains of L and H chains) {Fab F11.2.32 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d2hrpm2:

Click to download the PDB-style file with coordinates for d2hrpm2.
(The format of our PDB-style files is described here.)

Timeline for d2hrpm2: