![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (32 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225745] (14 PDB entries) |
![]() | Domain d3iu1b1: 3iu1 B:115-295 [211954] automated match to d1iyka1 complexed with mya |
PDB Entry: 3iu1 (more details), 1.42 Å
SCOPe Domain Sequences for d3iu1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iu1b1 d.108.1.0 (B:115-295) automated matches {Human (Homo sapiens) [TaxId: 9606]} rsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelyt llnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanih iydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtc r
Timeline for d3iu1b1: